Scaffold Ga0134545_1006817

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134545_1006817

Scaffold Ga0134545_1006817

Overview

Basic Information
Taxon OID	3300029310 Open in IMG/M
Scaffold ID	Ga0134545_1006817 Open in IMG/M
Source Dataset Name	Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10010
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bologna
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4270
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location Name	Tanzania
Coordinates	Lat. (^o)	-3.6347588	Long. (^o)	35.0828588	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134545_10068173	F067844	N/A	MNTLAAETASAWYLILNRKLQTLPIYITQLSSYLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVFGGP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.