Basic Information | |
---|---|
Taxon OID | 3300029310 Open in IMG/M |
Scaffold ID | Ga0134545_1005032 Open in IMG/M |
Source Dataset Name | Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10010 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bologna |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5417 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tanzania | |||||||
Coordinates | Lat. (o) | -3.6347588 | Long. (o) | 35.0828588 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074899 | Metagenome / Metatranscriptome | 119 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134545_10050325 | F074899 | N/A | MSGRKQWNKQAATSSFLNKKTPQSLIQHGLEGSTAVGKDEVGSSNLPSSSNKTL |
⦗Top⦘ |