Scaffold Ga0134545_1003610

Overview

Basic Information

• Taxon OID: 3300029310
• Scaffold ID: Ga0134545_1003610
• Source Dataset Name: Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10010
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bologna
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6948
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location

• Location Name: Tanzania
• Coordinates
  • Lat. (^o): -3.6347588
  • Long. (^o): 35.0828588

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056682	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134545_10036107	F056682	N/A	MKMQSRAGKVANQSVGQSEMYPASFWAFPSKNRSTIPIQELGKIYEKQEVL