Scaffold Ga0134545_1000160

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134545_1000160

Scaffold Ga0134545_1000160

Overview

Basic Information
Taxon OID	3300029310 Open in IMG/M
Scaffold ID	Ga0134545_1000160 Open in IMG/M
Source Dataset Name	Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10010
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bologna
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	57183
Total Scaffold Genes	104 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	94 (90.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location Name	Tanzania
Coordinates	Lat. (^o)	-3.6347588	Long. (^o)	35.0828588	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067720	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134545_10001607	F067720	AGGAG	MSSTTYEHFVDANKMYAAREQFRHLTKMVCDFVKVNKIDHLGNVTVMVRNAGQLPQPFWLGAACGGGSHSLSASVARA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.