Scaffold Ga0183683_1019703

Overview

Basic Information

• Taxon OID: 3300029309
• Scaffold ID: Ga0183683_1019703
• Source Dataset Name: Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1402
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_100
• Coordinates
  • Lat. (^o): -13.0023
  • Long. (^o): -95.9759
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100995	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0183683_10197031	F100995	AGGCGG	MTDKQLVKRIIELALKIKDTEQLTKVSEELRTMEIEKMFTTKEGKYYTLNT