Scaffold Ga0183683_1000396

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183683_1000396

Scaffold Ga0183683_1000396

Overview

Basic Information
Taxon OID	3300029309 Open in IMG/M
Scaffold ID	Ga0183683_1000396 Open in IMG/M
Source Dataset Name	Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	24530
Total Scaffold Genes	40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	34 (85.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	South Pacific Ocean: TARA_100
Coordinates	Lat. (^o)	-13.0023	Long. (^o)	-95.9759	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069448	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183683_100039623	F069448	GGAGG	MEAVQRIEVRGSRVEYVVYCDWCAGHGFVSDAHGDVVDCDKCHGTCIKFQHVVGGDDA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.