| Basic Information | |
|---|---|
| Taxon OID | 3300029308 Open in IMG/M |
| Scaffold ID | Ga0135226_1028389 Open in IMG/M |
| Source Dataset Name | Marine harbor viral communities from the Indian Ocean - SRB2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Michigan State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 564 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indian Ocean | |||||||
| Coordinates | Lat. (o) | 3.715 | Long. (o) | 105.408333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039956 | Metagenome | 162 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135226_10283892 | F039956 | N/A | RIFVASLSFPVTIMAAGGTPLPPGMGPYGNVAPLGDPLSVLSPLGLDAGRRLRSVKDAETLRDATNILLPTVRKFSEQAKRDDFARDMASAGIKQNILTNAALTENMQRAGLNMGMNAANQAGAALTARYNY |
| ⦗Top⦘ |