Scaffold Ga0307249_10601160

Overview

Basic Information

• Taxon OID: 3300029305
• Scaffold ID: Ga0307249_10601160
• Source Dataset Name: Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples.
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2298
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4204
  • Long. (^o): -119.6671
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036999	Metagenome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307249_106011604	F036999	AGGAGG	MNLLRYFGIGAKKILAMDCHVPGTVTHVGRSYLYVVKKPVRLYVHEGNTMFSHFIHFTYAVNGVQYKGRLWVSLRYRCPQKGEQLDVYYDPEKPQNYAFYSFGPNPNPIGW