NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307249_10040356

Scaffold Ga0307249_10040356


Overview

Basic Information
Taxon OID3300029305 Open in IMG/M
Scaffold IDGa0307249_10040356 Open in IMG/M
Source Dataset NameGoal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples.
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24272
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (89.66%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.4204Long. (o)-119.6671Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059514Metagenome133N

Sequences

Protein IDFamilyRBSSequence
Ga0307249_1004035628F059514GAGMHLVLTPDVFALRLNTAIFDCFAVEKRKFRATKKPTVGFFEQRLRQ
Ga0307249_100403566F059514GAGMHLVLTPDVFALRLNTAIFDCFAVENCKFHATKKPTVGFFEQRLRQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.