Scaffold Ga0119857_1003702

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119857_1003702

Scaffold Ga0119857_1003702

Overview

Basic Information
Taxon OID	3300029304 Open in IMG/M
Scaffold ID	Ga0119857_1003702 Open in IMG/M
Source Dataset Name	Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3734
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor → Anaerobic Bioreactor Microbial Community Of Freshwater Lake And Wastewater Samples From Australia

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028211	Metagenome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119857_10037024	F028211	AGGAG	MESIWMGIAPGTKATRVIAMSGPSELLMKARLEREPKHPRALATLLEAMALWQGAPVRAALCADSARPTCDSSLFREAFLDDGGALFSVVWVPVRAGRPRRDHLHGLGSFRDLERLVVEEVAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.