| Basic Information | |
|---|---|
| Taxon OID | 3300029304 Open in IMG/M |
| Scaffold ID | Ga0119857_1002205 Open in IMG/M |
| Source Dataset Name | Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5726 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor → Anaerobic Bioreactor Microbial Community Of Freshwater Lake And Wastewater Samples From Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045540 | Metagenome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119857_10022055 | F045540 | AGGA | MLRYLYTLAMLLDSKSKIRKHYSADIVISNLFDENLDEIDFIKSLSELELIYGFEIPDSLYDQTDITLGKFAYELSQLPKVSDQLYPEFFDIKFTSMKLMEKWIPLEDKTDEESISERDEINQQFELLNYRLNILLGNVLVN |
| ⦗Top⦘ |