NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0135222_1013311

Scaffold Ga0135222_1013311


Overview

Basic Information
Taxon OID3300029301 Open in IMG/M
Scaffold IDGa0135222_1013311 Open in IMG/M
Source Dataset NameMarine harbor viral communities from the Indian Ocean - SRH1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMichigan State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location
Location NameIndian Ocean
CoordinatesLat. (o)1.26600833Long. (o)103.8333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005819Metagenome / Metatranscriptome389Y

Sequences

Protein IDFamilyRBSSequence
Ga0135222_10133111F005819N/AMDYIDDMSLALPNQQQVGESNIDYKRFQYYLALGAGRTLPRVAENFSLSERRIYQISAKNQWQDRVKAINKMLNEQIIGEVFAQVGETARDLAEELKPVIFKVISEINERDLASMNPTELKGILDICYKMISQIYGLGQPQVTVNHIEQPQIRFKWDWEQNDEPDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.