Scaffold Ga0135211_1010682

Overview

Basic Information

• Taxon OID: 3300029293
• Scaffold ID: Ga0135211_1010682
• Source Dataset Name: Marine harbor viral communities from the Indian Ocean - SCH2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Michigan State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 866
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location

• Location Name: Indian Ocean
• Coordinates
  • Lat. (^o): 1.26600833
  • Long. (^o): 103.8333333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032244	Metagenome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135211_10106822	F032244	N/A	MANDVNIIVLCDEIYKGLKAKGCGMSPVEALEKTDLGTDKSFNGTFTNIIFQALNKARNR