Scaffold Ga0265297_10696391

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265297_10696391

Scaffold Ga0265297_10696391

Overview

Basic Information
Taxon OID	3300029288 Open in IMG/M
Scaffold ID	Ga0265297_10696391 Open in IMG/M
Source Dataset Name	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	635
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location Name	Canada: Waterloo, Ontario
Coordinates	Lat. (^o)	43.442	Long. (^o)	-80.577	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090570	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0265297_106963911	F090570	AGG	MDEFGNAYIEKVWCNSVRTPKPLKVIPYEKDFKVFFSVKGTEIGRITIGIFVDDILDQMLTTNILEKNKSLAIWFWYPYKRKQIGKHVIQFKIGEATDRTADSVTWKYTSDK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.