| Basic Information | |
|---|---|
| Taxon OID | 3300029288 Open in IMG/M |
| Scaffold ID | Ga0265297_10100518 Open in IMG/M |
| Source Dataset Name | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2307 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Waterloo, Ontario | |||||||
| Coordinates | Lat. (o) | 43.442 | Long. (o) | -80.577 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062245 | Metagenome / Metatranscriptome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265297_101005183 | F062245 | AGGAGG | MTVCLETTIQRYNGQDGEQVSITDPPEGSTFHAVDTGKKYIFHDGGWTEDLREIYVKTYV |
| ⦗Top⦘ |