Scaffold Ga0168097_1007147

Overview

Basic Information

• Taxon OID: 3300029255
• Scaffold ID: Ga0168097_1007147
• Source Dataset Name: Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3840
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.844519
  • Long. (^o): 17.659844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048337	Metagenome / Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0168097_10071471	F048337	AGCAGG	MARKENNKMIEKQVTFEGILREDEEQSNETVMLQDYRIAAITKGATYVLIDALPYDFIIQNMFYRVKEAFDGTIDLGTDANHSRIHADANFVKTVGKRSVAKSIMLDAGTPIKLFMGAGTTGKIEVHVTGFLLKPSLL