Scaffold Ga0167179_1027706

Overview

Basic Information

• Taxon OID: 3300029252
• Scaffold ID: Ga0167179_1027706
• Source Dataset Name: Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Gothenburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1143
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location

• Location Name: Sweden
• Coordinates
  • Lat. (^o): 59.310676
  • Long. (^o): 18.108437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081380	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167179_10277061	F081380	GAG	MKSAPEYLNNPEGKRLWFQDFRPHFNYLVLDPIKKFPLKMDDMLIGFVFMSCCIDYLSGFWWGENRELGMSRQAYVGFINEYFRPRGLYNAKGLYDSLRNGLVHLFTIKNKMYELTFDEPERHLTVNRMGYTVLDAASFRKDLIVAANLYFDDVEKNPQLLDKAFERYERDGFVHWID