Basic Information | |
---|---|
Taxon OID | 3300029252 Open in IMG/M |
Scaffold ID | Ga0167179_1021962 Open in IMG/M |
Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1372 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 59.310676 | Long. (o) | 18.108437 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025668 | Metagenome | 200 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167179_10219622 | F025668 | N/A | XXXVKTEYGCKRIIDIRALFKSHNDSEVIKFLKDYLREKEKTLKNMILIDKSHPKVDQIVAAMFRISMAIKSLEEGKGVIKLERSQQGTEESGRFHKRDSGGHSGPRKWQDARHDGKDRKSGQTIQRAA |
⦗Top⦘ |