NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167179_1015932

Scaffold Ga0167179_1015932


Overview

Basic Information
Taxon OID3300029252 Open in IMG/M
Scaffold IDGa0167179_1015932 Open in IMG/M
Source Dataset NameBiosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Gothenburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1733
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)59.310676Long. (o)18.108437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069750Metagenome / Metatranscriptome123N
F078674Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0167179_10159322F078674GGAGGMDALKKAIENRKAPFEVESKAGGRVISLRVSERMEQLLEEQAQEWNMSISDTLRSILNFYFLPPLLLEAWEKKVQALIELDTQQTGKNRADMNAPTQAQRIEPVLVDSEEAEEYAKFINELWDKNVKYWETLRVEALSMSKIALKRLTETVEALRKAREQLKEAEVEQ
Ga0167179_10159323F069750N/AMFELSFFXXXXLQENSFFIEGERFVIKERKSRKGKKTQYYLIRLQPFQYVSSLFPTGEGESYTFDFEQKLYRLERKEHSVTLRFV
Ga0167179_10159324F069750AGGAGLQENSFFIEGERFVIKERKSRKGKKTQFYLIKLPFQYVSSLFPTGEEGGFTFDYEQKLYKLEKKEHSIILKYV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.