Scaffold Ga0168692_107637

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168692_107637

Scaffold Ga0168692_107637

Overview

Basic Information
Taxon OID	3300029194 Open in IMG/M
Scaffold ID	Ga0168692_107637 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011681-56
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2473
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location Name	China: Beijing, Peking Union Medical College
Coordinates	Lat. (^o)	39.911947	Long. (^o)	116.4156125	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071325	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0168692_1076374	F071325	N/A	ALLSDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFHLHAVRFPAAFLLVHRFYLAFEELLSCATAYL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.