NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168800_106264

Scaffold Ga0168800_106264


Overview

Basic Information
Taxon OID3300029123 Open in IMG/M
Scaffold IDGa0168800_106264 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019858-133
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4708
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (71.43%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location NameChina: Beijing, Peking Union Medical College
CoordinatesLat. (o)39.911947Long. (o)116.4156125Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099451Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0168800_1062649F099451N/AMKIKNIGQLRKIIENLSDDFEIEMRIRRKLTDEELKNCRYPYPYDTEYLTLEFDDIGVSNKVLCLGVTSNE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.