| Basic Information | |
|---|---|
| Taxon OID | 3300029121 Open in IMG/M |
| Scaffold ID | Ga0168811_104517 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021205-19 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3946 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → unclassified Roseburia → Roseburia sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Beijing, Peking Union Medical College | |||||||
| Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097172 | Metagenome / Metatranscriptome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168811_1045173 | F097172 | AGGAGG | MKKNVFKKLMCAVLATACVATAVVPAMADDVVTAEAATRKVTSAYKHHIDGYDKKGYPIDGFSKTSFYKDLNSLPSVKTGKTTINVPAVTSSVKSVSKEKGEPCYESYVKFKAPKTGKYVVTLNNLQGTDDKSLKSLSCSLCEIAKTGKKYTLSGFEPDCNTVGKYDTLYENNYLARLRTILDNYKAEHPEYADVIEYDYNDYTDFVNKRPVDKIKFTTRLKKGQTYVFLINNALGKTTCKPYFTTHGSDEQSCLYNTNYLKAYSFDMNIEYRK |
| ⦗Top⦘ |