Basic Information | |
---|---|
Taxon OID | 3300029120 Open in IMG/M |
Scaffold ID | Ga0168814_113188 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021209-24 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1795 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Beijing, Peking Union Medical College | |||||||
Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081354 | Metagenome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0168814_1131882 | F081354 | N/A | VKDFSSIYPESRRRSPLKKGAVTEIPLEYGKTEVQIPFEPLQAAISSMELPKNFENKKLPNPLR |
⦗Top⦘ |