Scaffold Ga0168816_106140

Overview

Basic Information

• Taxon OID: 3300029119
• Scaffold ID: Ga0168816_106140
• Source Dataset Name: Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021211-26
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4957
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location

• Location Name: China: Beijing, Peking Union Medical College
• Coordinates
  • Lat. (^o): 39.911947
  • Long. (^o): 116.4156125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168816_1061409	F036964	AGGAGG	MEILKIVFPLLMVAGALGSLVVNIASKGDWATSLQWLGACLLYTALTVRNMS