Scaffold Ga0168816_104002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168816_104002

Scaffold Ga0168816_104002

Overview

Basic Information
Taxon OID	3300029119 Open in IMG/M
Scaffold ID	Ga0168816_104002 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021211-26
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7614
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location Name	China: Beijing, Peking Union Medical College
Coordinates	Lat. (^o)	39.911947	Long. (^o)	116.4156125	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013656	Metagenome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168816_10400210	F013656	AGGA	MKKIYKEPNKSEIETTINVLYSENILSICTNKVDLQKKLNKLLGEPAKEHKIKRSIAGSTWNISLDDKIKIKKIILKANIYDI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.