Basic Information | |
---|---|
Taxon OID | 3300028920 Open in IMG/M |
Scaffold ID | Ga0272441_10139537 Open in IMG/M |
Source Dataset Name | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2292 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Falmouth, Massachusetts | |||||||
Coordinates | Lat. (o) | 41.5758 | Long. (o) | -70.6394 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025653 | Metagenome / Metatranscriptome | 200 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0272441_101395371 | F025653 | GGA | LSDPIKFFETKLKAMSLAELQAYKKRLDENIQQMIAKTVPNEKIAPLILYRGILEHEI |
⦗Top⦘ |