Scaffold Ga0272441_10076735

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0272441_10076735

Scaffold Ga0272441_10076735

Overview

Basic Information
Taxon OID	3300028920 Open in IMG/M
Scaffold ID	Ga0272441_10076735 Open in IMG/M
Source Dataset Name	Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3481
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States

Source Dataset Sampling Location
Location Name	USA: Falmouth, Massachusetts
Coordinates	Lat. (^o)	41.5758	Long. (^o)	-70.6394	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076639	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272441_100767353	F076639	AGGA	MKGPESQSKPERAPIYWMHEAIMYLGFDRLGLARPEKAIYRLIEKGILNPRKIAGRFAFDKKELELLAANGDKKRGKGRPRKIFPA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.