Scaffold Ga0272441_10043904

Overview

Basic Information

• Taxon OID: 3300028920
• Scaffold ID: Ga0272441_10043904
• Source Dataset Name: Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5143
• Total Scaffold Genes: 19
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (63.16%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M9B1D (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States

Source Dataset Sampling Location

• Location Name: USA: Falmouth, Massachusetts
• Coordinates
  • Lat. (^o): 41.5758
  • Long. (^o): -70.6394
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015411	Metagenome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272441_1004390414	F015411	AGGAGG	MRRKGFGRKDGSQRGFKQGGRGRNKTTTCRNPFIKKNRMKK