Scaffold Ga0310376_1037940

Overview

Basic Information

• Taxon OID: 3300028916
• Scaffold ID: Ga0310376_1037940
• Source Dataset Name: Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto, Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1027
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium 4484_219 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 36.0
  • Long. (^o): -97.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081504	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310376_10379401	F081504	GAGG	MPICVKCGSQAAYWTIIDKENNSKDYCDSCFKKYDLAKVKKEMDEYQRKRKENKTMY