Basic Information | |
---|---|
Taxon OID | 3300028916 Open in IMG/M |
Scaffold ID | Ga0310376_1018249 Open in IMG/M |
Source Dataset Name | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto, Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1905 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oklahoma | |||||||
Coordinates | Lat. (o) | 36.0 | Long. (o) | -97.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F093911 | Metagenome / Metatranscriptome | 106 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0310376_10182491 | F093911 | N/A | DSVFLTQNRSTEMVTISYLSMGSNYNWSIDDGESMMAYVGPVNDLSNAGSLNNAGSILFLYKDSTIINTGTITNTGHIALQAI |
⦗Top⦘ |