Basic Information | |
---|---|
Taxon OID | 3300028916 Open in IMG/M |
Scaffold ID | Ga0310376_1000748 Open in IMG/M |
Source Dataset Name | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto, Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 45939 |
Total Scaffold Genes | 43 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 31 (72.09%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oklahoma | |||||||
Coordinates | Lat. (o) | 36.0 | Long. (o) | -97.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050777 | Metagenome / Metatranscriptome | 145 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0310376_100074836 | F050777 | GAG | MEDDIIYEKAVEILNPGRLYFALKAMHSSPVKISFDMGDLNLTSGPVSSLISIEGDLPEEVQDMQWLVSLEDLLILQDLIPPDTYYWENRALVLEWQCDLVVDSMIDEKSPVETLEQEEAYRDQLLVSNREYRELQMALDDCNAHIPQVLFSIYPDRLNFAVNCSEHDEIVGTMIQLKNL |
⦗Top⦘ |