| Basic Information | |
|---|---|
| Taxon OID | 3300028914 Open in IMG/M |
| Scaffold ID | Ga0265300_10002521 Open in IMG/M |
| Source Dataset Name | Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_03 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 15774 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (15.79%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Australia: Woodstock, Queensland | |||||||
| Coordinates | Lat. (o) | -19.6574 | Long. (o) | 146.8351 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051611 | Metagenome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265300_1000252116 | F051611 | N/A | MVKDKVTKEDLLKFNVGDQKVFTLPSFGKARSAQSYANQQKKATIGTTNPMEFKAVIGDPIPETGQCSVTITRIA |
| ⦗Top⦘ |