| Basic Information | |
|---|---|
| Taxon OID | 3300028886 Open in IMG/M |
| Scaffold ID | Ga0256407_10402278 Open in IMG/M |
| Source Dataset Name | Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_04 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1081 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. E2-28 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 49.6935 | Long. (o) | -112.8418 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039427 | Metagenome / Metatranscriptome | 163 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256407_104022781 | F039427 | N/A | IMSKKVFALVSGIVGGLQTIGVALVTYNNPEYVTAINSAIVIAGAAIIEICNLFVKTEA |
| ⦗Top⦘ |