NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256407_10014873

Scaffold Ga0256407_10014873


Overview

Basic Information
Taxon OID3300028886 Open in IMG/M
Scaffold IDGa0256407_10014873 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10145
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (35.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. oral taxon 299 → Prevotella sp. oral taxon 299 str. F0039(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051611Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0256407_100148735F051611N/AMVKDKVTKEDLMKFNVGDQKVFTLPNFAKARSAQSYANQMKKATMGTKDQREFSAVIGDPDPETGRCGVTITRTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.