| Basic Information | |
|---|---|
| Taxon OID | 3300028883 Open in IMG/M |
| Scaffold ID | Ga0272443_10190763 Open in IMG/M |
| Source Dataset Name | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1024 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Falmouth, Massachusetts | |||||||
| Coordinates | Lat. (o) | 41.5758 | Long. (o) | -70.6394 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060598 | Metagenome / Metatranscriptome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272443_101907631 | F060598 | N/A | MVLAYDLDAHLWLGLRTYHGTKKLSKGLVEIVRELLKHRGSLKGRLRLFFDKGGYSGLIFLALSKESGVRFYVPAMRYASNVTQWEQLQEDDFDATLFTFDKHADWPVDRRPVYRLADTEMTLNVREGGKVVDTVTLRAVVLHDPQGEKPAERWPVVILTDDREIDAQALLNEYGDHWGQETAHRIGKHDLYLDILPPGYVLKTQRDDQGELQREVTFDQTAFFLSGWLRCLVFNLMTRFAEEMGGEYTKMWAGTLLRKFIRRPATLYLVGKDLHVVFEPFPGQDELQPLLDKLNAKRTALPWLNNLVVQFSIAQDESVHPLTEPEKRNRLFGDG |
| ⦗Top⦘ |