| Basic Information | |
|---|---|
| Taxon OID | 3300028882 Open in IMG/M |
| Scaffold ID | Ga0302154_10565384 Open in IMG/M |
| Source Dataset Name | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 537 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Abisko, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0477 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003186 | Metagenome / Metatranscriptome | 502 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0302154_105653841 | F003186 | N/A | VDGSVINPKTILGEWVTALQSCPDLVDALGGDGDNIRAFMEGLATDNNLRLAILQMPPGSILVAWNGTTPRRLTGGSLHFAHRFSIYLRAPEQNSTATYADLFWLLVSAIPTGAPSWASLLHFQIDPDCYPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQGNPGGE |
| ⦗Top⦘ |