NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307277_10208620

Scaffold Ga0307277_10208620


Overview

Basic Information
Taxon OID3300028881 Open in IMG/M
Scaffold IDGa0307277_10208620 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)857
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076993Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0307277_102086203F076993N/ALIAAVAATIASLALAWARKGAVADLLNGVLDHVRSLFGMG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.