NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302197_10259080

Scaffold Ga0302197_10259080


Overview

Basic Information
Taxon OID3300028873 Open in IMG/M
Scaffold IDGa0302197_10259080 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)794
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003186Metagenome / Metatranscriptome502N
F010139Metagenome / Metatranscriptome308Y
F103703Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0302197_102590801F010139GAGGMETVFMRSPDGEVKEVEATTEALTPRMASGWHQVPAPPVAQKPVVVAE
Ga0302197_102590802F003186GAGVINPKTILGEWVTALQSCPDLVDALGGDGDNIRAFMEGLATDNNLRLAILQMPPGSILVAWNGTTPRRLTGGSLHFAHRFSIYLRAPEQNSTATYADLFWLLVSAIPTGAPSWASLLHFQIDPDCYPMDMDLPSAQRNTVVVSADGTTLDYFEVQATLVEQGNPGGE
Ga0302197_102590803F103703N/ANFANPPAKGDWVTAWGAQYVVTTVRQPDAYGMLNLALLQRAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.