Scaffold Ga0247610_11132329

Overview

Basic Information

• Taxon OID: 3300028833
• Scaffold ID: Ga0247610_11132329
• Source Dataset Name: Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1742 DNA GHGhigh gp2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 780
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Litostomatea → Trichostomatia → Entodiniomorphida → Ophryoscolecidae → Entodinium → Entodinium caudatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: New Zealand: Palmerston North, Manawatu-Wanganui
• Coordinates
  • Lat. (^o): -40.3794
  • Long. (^o): 175.6106

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019573	Metagenome / Metatranscriptome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247610_111323291	F019573	N/A	MSYVPQENYGQSSVQAEPLNLGPNIFPAQPGQLPPEAYQSQTPTVRTLPPKIVKNTLPPQYKTQNLPPKVVTTKLQPIFPPGTAPTSIPGF