Scaffold Ga0247610_10351262

Overview

Basic Information

• Taxon OID: 3300028833
• Scaffold ID: Ga0247610_10351262
• Source Dataset Name: Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1742 DNA GHGhigh gp2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1543
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: New Zealand: Palmerston North, Manawatu-Wanganui
• Coordinates
  • Lat. (^o): -40.3794
  • Long. (^o): 175.6106

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075523	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247610_103512623	F075523	N/A	MDTQSIDDQLELLRLKELFMSDIKTRSEMAMLICEEDSSHKEFCELTHCTPDIAKMFAEQLLMDVFLTPEEIAAERERLERMKL