Scaffold Ga0265298_10001221

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265298_10001221

Scaffold Ga0265298_10001221

Overview

Basic Information
Taxon OID	3300028832 Open in IMG/M
Scaffold ID	Ga0265298_10001221 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_01
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	37991
Total Scaffold Genes	70 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	61 (87.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	Australia: Woodstock, Queensland
Coordinates	Lat. (^o)	-19.6574	Long. (^o)	146.8351	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067315	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265298_100012213	F067315	GGAG	MNNFQNSINFLANIIQLLSYEILVEDFNNTDLMKYLNHQDELLDKIIEQNDQIISLLKGEKKXENT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.