Scaffold Ga0247825_10470978

Overview

Basic Information

• Taxon OID: 3300028812
• Scaffold ID: Ga0247825_10470978
• Source Dataset Name: Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 892
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.673
  • Long. (^o): -77.032
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035934	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247825_104709782	F035934	GAGG	MRRLAIPAVLAPALLVGCSARAEKTAGTLAELRQMRPDVQEVRVEQGLDQAMHHY