NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247825_10131096

Scaffold Ga0247825_10131096


Overview

Basic Information
Taxon OID3300028812 Open in IMG/M
Scaffold IDGa0247825_10131096 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1711
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044524Metagenome / Metatranscriptome154Y
F066753Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0247825_101310962F066753GGGGGMAKSSAARDDSQRAAFKAILSELPEDHPARAAYVAGADAIQLMNLVEREDLVEKLNQAWLDWYSTRLRLQRTGGAA
Ga0247825_101310963F044524N/AMTSINFEQARAAHLALQEFFAAHPKGRLDAAAFLDVKVLCQQAERVVPDVECRRAIRSIVNYSELLTSREPAERGADFVRLRVQNALASLRSQLKAIEAGEVTAL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.