| Basic Information | |
|---|---|
| Taxon OID | 3300028805 Open in IMG/M |
| Scaffold ID | Ga0247608_10032143 Open in IMG/M |
| Source Dataset Name | Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 DNA GHGlow gp2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4858 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Zealand: Palmerston North, Manawatu-Wanganui | |||||||
| Coordinates | Lat. (o) | -40.3794 | Long. (o) | 175.6106 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046769 | Metagenome / Metatranscriptome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247608_100321432 | F046769 | AGG | MITNSSLTIYHKGIDEETRLETWTKYIYENVWFYGGKGAGINEGYVDANDVQIRIPYSKNDGLDFGNFSIGDIVVQGTLSQNIQTQQDLVDYQTYNIVSLNNNTFGSRPHIHIGGK |
| ⦗Top⦘ |