NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265301_10464469

Scaffold Ga0265301_10464469


Overview

Basic Information
Taxon OID3300028797 Open in IMG/M
Scaffold IDGa0265301_10464469 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)942
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameAustralia: Woodstock, Queensland
CoordinatesLat. (o)-19.6574Long. (o)146.8351Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011198Metagenome / Metatranscriptome294Y

Sequences

Protein IDFamilyRBSSequence
Ga0265301_104644692F011198N/AMKENRPKTSCLSTKKRPSIDIFNNNFDTHTNYRKTFFNQEKDKGDPFFRTTRVGSCRKVVVKNGIPFALTFKVKNPRGEPLTHYKFTAKEKPRLPTTYQIDYCSEKNECHLGMKKKPLVPYLATHKRNQLPDDVKFRVLRNFSNFTIGNEGLINRKQWISTYNDSYQKTKIYRISNPGIRSDMAKRAHYQLNNIEYKYGKYH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.