NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302279_10000063

Scaffold Ga0302279_10000063


Overview

Basic Information
Taxon OID3300028783 Open in IMG/M
Scaffold IDGa0302279_10000063 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)141535
Total Scaffold Genes119 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)75 (63.03%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023377Metagenome / Metatranscriptome210Y
F031516Metagenome / Metatranscriptome182Y
F044583Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0302279_1000006357F031516GGCGGMVDIRFPSSVDMLHFDTAQMAAITQAHFFSRVAEFIRDQTTVAAYRQAALDTTLRTALWAPHWPTLRAASEHDAALFMCFLLACATLGVDATRAAEAVRQASQPETSMKLFLSERGLLRFSAFDVPDLTRPNAEA
Ga0302279_100000638F023377AGGMTHRPVCSPRAIRMAMGAALVLAAAGAQAMTVSYQCTGRRVLTAELTPGEGQLHFEGQNWTVMRVRGGREAHYANSKQGVDVVTKERTMTFRHGTETLQCFLFSDALPGDAPHTTN
Ga0302279_1000006394F044583AGGAGGMSYALSPNQEILRARIRFALRRATGFVFDIDAMLRKPELRARRIGLWRDVADDELSTLLDQLETEFQMDAPSDDDSAERTIVIRRQDLPDTHR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.