NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302225_10038083

Scaffold Ga0302225_10038083


Overview

Basic Information
Taxon OID3300028780 Open in IMG/M
Scaffold IDGa0302225_10038083 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2401
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000364Metagenome / Metatranscriptome1229Y
F000976Metagenome / Metatranscriptome816Y

Sequences

Protein IDFamilyRBSSequence
Ga0302225_100380832F000364GAGGVRRYLLVLDMDLLALDEELDLAPINYLLAQQEREPCEVTVMSLAWTRQAKLPAMELLLGAQAGKFPVAPRPDHDISADAEHRMNLAMRHLTTIGCQASGLISDENDLVKAVRTETRRHEYDGVILATGRQRGSWPARRLHLDPIHRLRWHWGQRLVVFSLGPGASHPTPSA
Ga0302225_100380833F000976GGAMAAAIRVTPAYVSLGALAFASCRVDTGWVTPVAGFLFAIALPTAAGFALIGAWRAARWLGEVRCKALPPEPIERLEADLRRLRAELEETETRSGLTAKHHRVQALRGAYADTLSAACRRLDISPPPGGDRAPQAEIYLVEAELRQR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.