NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272447_1024274

Scaffold Ga0272447_1024274


Overview

Basic Information
Taxon OID3300028761 Open in IMG/M
Scaffold IDGa0272447_1024274 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1192
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5761Long. (o)-110.7905Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065808Metagenome / Metatranscriptome127Y
F081381Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0272447_10242743F081381AGGAGGMNYWNEREELRHLQERYERDIAQWRSEYAALHAEWEAVAYHNRRLRVVLLEIVRAYRAEDPNRLREAVERAVDFLGLDEEVVTW
Ga0272447_10242744F065808AGGAGGMVIRVAEERVYYFPHPMITATCCDDHAEIVVIPDPEKTARWRFRVSFKTAYESDEDFWELGDKFVLPLYIQQALEKKCLYVDEEVSR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.