NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302233_10083817

Scaffold Ga0302233_10083817


Overview

Basic Information
Taxon OID3300028746 Open in IMG/M
Scaffold IDGa0302233_10083817 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1269
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002396Metagenome / Metatranscriptome564Y
F003157Metagenome / Metatranscriptome504Y
F099394Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0302233_100838171F099394N/ASDIGFSFLTASEVVLPLTEQQNPRKSGCFQETEVSSI
Ga0302233_100838173F002396GAGGMRSLFPSTYDRADVLMSAGCSTFVSAALILVIPRVGIILLKILLGLFFIGCALAARARLRIQARSQVKEGPEGSTNAKAKWFDRYDVLMILTVIAVYSGVSGLLRHEGLSEGTVGILPLILFAAGILLKPRAVQFIERRRKDRTTETHDGRAHVDAGEKQDIARKETVERCQ
Ga0302233_100838174F003157N/ARKRENTDPLGFARFGGLDRLDWLMIVVSVLLGTVAKQHHVLDLPDWFLEWVSPFLLMVFGYKARRKITEVVQSRRDRGKGSPEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.