NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302292_1000339

Scaffold Ga0302292_1000339


Overview

Basic Information
Taxon OID3300028738 Open in IMG/M
Scaffold IDGa0302292_1000339 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33212
Total Scaffold Genes48 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)40 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0469Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092957Metagenome / Metatranscriptome107Y
F096508Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0302292_100033910F096508GAGGMKKQRIKPAQLEKLLAAHDLKKYDICKICDVSAATAERYMKYGIPQAQYRLIALSLGDL
Ga0302292_100033946F092957N/AMNLRGLTSMVAARVADTDCVVTYDALVDNDDGSCTVTPTTMTLKASIHALQPVDIQRLREGGIEVQNGVSILLAEALEERPEKIVADGRSWRILTWTFVSAYDNESGMPIGTVVAVCDEIRVAAVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.